PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.WC8FK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB_related
Protein Properties Length: 90aa    MW: 10296.1 Da    PI: 9.846
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.WC8FKgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.91.1e-132265548
                     -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     ++ Ede+l+ +++++G g+W+++++  g+ R++k+c +rw +yl
      Aradu.WC8FK 22 SPKEDEKLLMYITKYGHGCWSSVPKQAGLQRSGKSCSLRWINYL 65
                     789***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.0051369IPR017930Myb domain
SMARTSM007172.7E-61767IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-182270IPR009057Homeodomain-like
SuperFamilySSF466891.5E-132274IPR009057Homeodomain-like
CDDcd001672.89E-92265No hitNo description
PfamPF002491.3E-112265IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MNNNGKTLLL LQAEASEGSM VSPKEDEKLL MYITKYGHGC WSSVPKQAGL QRSGKSCSLR  60
WINYLRPDLK FGIFLLLLFS LQPQFRYLLL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002968634.16e-29hypothetical protein SELMODRAFT_90153, partial
SwissprotQ8LPH67e-27MYB86_ARATH; Transcription factor MYB86
TrEMBLB3H6649e-28B3H664_ARATH; Myb domain protein 55
TrEMBLD8RDI46e-29D8RDI4_SELML; Putative uncharacterized protein (Fragment)
STRINGBra036317.1-P1e-26(Brassica rapa)
STRINGEFJ297502e-28(Selaginella moellendorffii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.38e-28myb domain protein 55